DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and ea

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:296 Identity:95/296 - (32%)
Similarity:140/296 - (47%) Gaps:60/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPTATASPFVILP---------KIVGGYTVTIDQVPFQVSVRRRSIHERHYG-LGHVCGGAVISQ 78
            :|..|::..:.||         :|.||....||:.|:...:.    :.:..| .||.|||::||.
  Fly   105 KPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIE----YTKSQGKKGHHCGGSLIST 165

  Fly    79 RVVCSAAHCYAIN-TSVPLVYR-------------DPELYVVVAG--SSAIDRTDRFTQEYLVQR 127
            |.|.:|:||  :| .::|..:|             :|:..|.|.|  ..|....|     ..|:|
  Fly   166 RYVITASHC--VNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLD-----VPVER 223

  Fly   128 IVGHKDYNGSTLE--NDIALLFLNGFIPWESPGVRAI--PLAI---KAPEEGTTCLIHGWGKVTM 185
            .:.|.||..::..  ||||||.|...:.: :..||.|  ||.:   .|..:|.|..:.||||...
  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEY-TDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQ 287

  Fly   186 KEKSASLQQAPVPILNKELCQVIYK-----LPASQMCAGFLQGGIDACQGDSGGPLI-CDGR--- 241
            ...|....:|.|.....:.||.:|.     |..:|||||..: |:|:|:|||||||| .|..   
  Fly   288 LSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLIGLDTNKVN 351

  Fly   242 ----LAGIISWG-VGCADPGYPGVYTNVSHFLKWIR 272
                |||::|:| ..|...|:|||||.|..::.||:
  Fly   352 TYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/271 (33%)
Tryp_SPc 38..273 CDD:238113 91/273 (33%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 89/271 (33%)
Tryp_SPc 128..389 CDD:238113 91/273 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.