DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG3505

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:241 Identity:70/241 - (29%)
Similarity:107/241 - (44%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HVCGGAVISQRVVCSAAHCYA------------------INTSVPLVYRDPELYVVVAGSSAIDR 115
            |.|||.:||.|.|.:||||.|                  .:|:....|.:        .|...|.
  Fly   135 HACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHE--------DSKVADC 191

  Fly   116 TDRFTQEYLVQRIVGHKDYNGS--TLENDIALL------FLNGFI-PWESPGVRAIPLAIKAPE- 170
            ...: |:..::.::.|..||.:  |..|||||:      .||.|: |...|..:     ::|.| 
  Fly   192 APPY-QDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQ-----LRADEL 250

  Fly   171 EGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIY-----KLPASQMCAGFLQGGIDACQG 230
            |.....:.||    ....|..:::..|.|.:.|.||..|     ::.||::| |....  ..|.|
  Fly   251 EDLVTEVAGW----QASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC-GLTNS--QECYG 308

  Fly   231 DSGGPLIC---DG-RLAGIISWG-VGCADPGYPGVYTNVSHFLKWI 271
            ::||||:.   || .|.|::|:| |.|.:|.:|.|||.|:.::.||
  Fly   309 NAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 68/239 (28%)
Tryp_SPc 38..273 CDD:238113 70/241 (29%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 70/241 (29%)
Tryp_SPc 111..354 CDD:214473 68/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.