DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG11668

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:303 Identity:83/303 - (27%)
Similarity:131/303 - (43%) Gaps:74/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 THSGITQSQIGQPTATASPFVILPK-------IVGGYTVTIDQVPFQVSV-----RRRSIHE--- 62
            |:..:.|.::.:|        |:.|       :|||.....::.|:..::     ..|.|||   
  Fly   124 TNPKLDQVELVEP--------IIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGS 180

  Fly    63 --RHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLV 125
              |.|...  ||.|:|:.|...:||||.::....|.|       .::.|   ::......|...:
  Fly   181 SKRRYTFN--CGCAMIAPRFAITAAHCASVGGESPSV-------ALIGG---VELNSGRGQLIEI 233

  Fly   126 QRIVGHKDYNGSTLENDIALLFL--NGFIP----WESPGVRAIPLAIKAPEEGTTCLIHGWGKVT 184
            :||..|..::..||.||:|::.|  ...:|    |....:         ||...|.|  |:|:..
  Fly   234 KRISQHPHFDAETLTNDLAVVKLARRSHMPVACLWNQESL---------PERPLTAL--GYGQTK 287

  Fly   185 MK-EKSASLQQAPVPILNKELCQ--------VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDG 240
            .. ..|::|.|..:..||.:.||        :...|.:.|||||...|.:|.|||||||||:...
  Fly   288 FAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQ 352

  Fly   241 RL----------AGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            .:          .||.|:|..||. |.||||..::|:::||.:
  Fly   353 HMRHHRHTIPYVVGITSFGGACAS-GQPGVYVRIAHYIQWIEQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/275 (28%)
Tryp_SPc 38..273 CDD:238113 78/269 (29%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 78/270 (29%)
Tryp_SPc 149..392 CDD:214473 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.