DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG10041

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:293 Identity:80/293 - (27%)
Similarity:131/293 - (44%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRR-----SIHERH 64
            |..|..:|..:.::.:   |.|.:.:|....|.:  ..||:..:|   :|.|.|     ||.|..
  Fly     4 WQSLCSIAWFAAMSAA---QETLSDTPQNSTPLL--ATTVSTTKV---ISFRPRYPYIVSIGENL 60

  Fly    65 YG-LGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ-- 126
            .| ..|:|.|.::|...|.|||||...|         |...:.|||.:....:.:.|:.::|:  
  Fly    61 KGYYKHLCVGVILSNEFVLSAAHCIQTN---------PTKQLYVAGGADSLNSRKQTRFFVVERR 116

  Fly   127 -----RIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAP-EEGTTCLIHGWGKVTM 185
                 |::|         .||||:|.:....|.:....|:|..|.|.. :.||...:.|||:|.:
  Fly   117 WHPQFRVLG---------GNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGV 172

  Fly   186 KEKSASLQQAPVPILNKELCQVIYK---LPASQMCAGFLQGGIDACQGDSGGPL--ICDGRLAGI 245
             .|...||:.|...:..:.||..::   |....:||..|:|....|.||||.||  :...:|.|:
  Fly   173 -GKIRKLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGL 236

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWIRRANASL 278
            :|:|.....|..|..:|.::.:..||:.:..|:
  Fly   237 LSYGRKACTPLKPYAFTRINAYSSWIQESMDSM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/252 (28%)
Tryp_SPc 38..273 CDD:238113 72/253 (28%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.