DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG12951

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:282 Identity:82/282 - (29%)
Similarity:134/282 - (47%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |.:.|:::     :..:.:||    |:|.:  .::|.|...::.:.||.||:       |.|...
  Fly     7 LSLSLIVI-----LAVTTVGQ----AAPSI--SRVVNGTDSSVLKYPFVVSL-------RSYDGS 53

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            |.|||::||:..|.:||||.....:..|..:.....:...|.:.:.          :::|:.|:|
  Fly    54 HSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVG----------IKKIIQHED 108

  Fly   134 YNGSTLE-NDIALLFLNGFIPWESPGVRAIP-----LAIKAPEE--GTTCLIHGWG-KVTMKEKS 189
            ::.:... |||:||.:..  |:|..||...|     ||...|:.  |...::.||| ..|.....
  Fly   109 FDPTRQNANDISLLMVEE--PFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQ 171

  Fly   190 ASLQQAPVPILNKELCQVIYK---LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGV- 250
            .:||:..:.|.:.|.|...:.   .|...:|.|..:||...|.||||||||.:|:..||:||.: 
  Fly   172 DTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIK 236

  Fly   251 GCADPGYPGVYTNVSHFLKWIR 272
            .|....|||||..||.::.||:
  Fly   237 PCTVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/246 (30%)
Tryp_SPc 38..273 CDD:238113 76/248 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/246 (30%)
Tryp_SPc 30..260 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.