DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG13318

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:102/246 - (41%) Gaps:80/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GGAVISQRVVCSAAH-------CY---------AINTSVPLVYRDPELYVVVAGSSAIDRTDRFT 120
            |||:|:.:.|.:|||       .|         |.:||.|:.                      .
  Fly   190 GGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIP----------------------A 232

  Fly   121 QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEE-GTTCL-------- 176
            |:..:..:..:..:|.:.|:||:|:|.|            :.|:::.:... ||.||        
  Fly   233 QDVYISNVYVNPSFNPNNLQNDVAILKL------------STPVSLTSKSTVGTVCLPTTSFVGQ 285

  Fly   177 ---IHGWGKVTMKEKSASL---QQAPVPILNKELCQVIYKL----------PASQMCAGFLQGGI 225
               :.||||.......|..   :|..||::....||...:.          |.|.:|||. :.|.
  Fly   286 RCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGG-EAGK 349

  Fly   226 DACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            |||.||.|.||:|...    :.|:::||:|||..|.||||.||..:|.||:
  Fly   350 DACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 65/243 (27%)
Tryp_SPc 38..273 CDD:238113 67/246 (27%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 67/246 (27%)
Tryp_SPc 169..399 CDD:214473 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.