DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:251 Identity:82/251 - (32%)
Similarity:128/251 - (50%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            |:.||......:.|:|.|:::.::|.        ||..:||...:.:||||:..:.       :|
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHR--------CGATLISNSWLITAAHCFVRSA-------NP 235

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRA-IPLA 165
            :.:.|..|.    ...:...:..|:.||.|::|:.....||||::.|:..:.:|:...|| :|.|
  Rat   236 KDWKVSFGF----LLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEA 296

  Fly   166 IKAPEEGTTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELCQ-------VIYKLPASQMCAGF 220
            .:.....:..::.|||  |:|....|   ||:..|.|::.:.|.       ||   ....:||||
  Rat   297 TQKFPPNSDVVVTGWG--TLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVI---TPGMLCAGF 356

  Fly   221 LQGGIDACQGDSGGPLICDGR-----LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |:|.:|||||||||||:.:..     ||||:|||..||.|..|||||.|:|:..||
  Rat   357 LEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/249 (32%)
Tryp_SPc 38..273 CDD:238113 81/250 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 80/249 (32%)
Tryp_SPc 187..415 CDD:238113 81/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.