DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk4

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:208 Identity:74/208 - (35%)
Similarity:110/208 - (52%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN 135
            |.|.::..:.|.|||||...:.:|.|...:.|      ||.  :...|..:.:|   .:.|.:||
  Rat    58 CSGVLVHPQWVLSAAHCIQDSYTVGLGLHNLE------GSQ--EPGSRMLEAHL---SIQHPNYN 111

  Fly   136 GSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPIL 200
            ..:..||:.|:.||..: .||..:|.||:|.:.|..|.|||:.|||::...:..:.||...:.:.
  Rat   112 DPSFANDLMLIKLNESV-MESNTIRRIPVASQCPTPGDTCLVSGWGRLKNGKLPSLLQCVNLSVA 175

  Fly   201 NKELCQVIYKLPA---SQMCAGFLQGG---IDACQGDSGGPLICDGRLAGIISWGVG-CADPGYP 258
            ::|.|:::|. |.   |..|||   ||   .|.|.||||||::|:..|.|::|.|.| |..||.|
  Rat   176 SEETCRLLYD-PVYHLSMFCAG---GGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIP 236

  Fly   259 GVYTNVSHFLKWI 271
            .||||:..|..||
  Rat   237 SVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 72/206 (35%)
Tryp_SPc 38..273 CDD:238113 74/208 (36%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 72/206 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.