DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG10663

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:126/272 - (46%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRV 80
            ||.:|..|:.:.:.     :.||:||......:.|:||::..|....       .|||.:|:.|.
  Fly   490 GIVRSGTGRRSMSN-----MLKIIGGRAARKGEWPWQVAILNRFKEA-------FCGGTLIAPRW 542

  Fly    81 VCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIAL 145
            |.:||||..            ::..|..|...::..|....:..|.:...|.:::..|:::|:||
  Fly   543 VLTAAHCVR------------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVAL 595

  Fly   146 LFLNGFI---PWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELC 205
            |.|...:   .|  .|...:|...:|..:...|.|.||||...::.:.:  |.:|.|||:..:.|
  Fly   596 LRLPKAVNATTW--IGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNC 658

  Fly   206 QVI---YKLPASQMCAGFLQGGIDACQGDSGGPLIC--------DGRLAGIISWGVGCADPGYPG 259
            :.:   |.:..:..|||..:|.||.|.|||||||:|        ...:.||.|:|.|||.....|
  Fly   659 RKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFG 723

  Fly   260 VYTNVSHFLKWI 271
            :|..|.:::.|:
  Fly   724 IYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/249 (29%)
Tryp_SPc 38..273 CDD:238113 71/250 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 71/249 (29%)
Tryp_SPc 507..735 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.