DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG18179

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:303 Identity:77/303 - (25%)
Similarity:113/303 - (37%) Gaps:68/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |.:.|.:||...|..::.: .|..|.|... ..:||.||.....:.|:.|.:..|:.......:|
  Fly     8 LSVALAVVAASPGFNRTSL-LPQVTISEGA-EGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG 70

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
               .|.:|:...:.:||||...:            ||.:...|.......|.|.......:.|.:
  Fly    71 ---AGTIIASDWILTAAHCLTTD------------YVEIHYGSNWGWNGAFRQSVRRDNFISHPN 120

  Fly   134 YNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEG----------------------TTCL 176
                                |.:.|.|.|.| |:.|..|                      |.|:
  Fly   121 --------------------WPAEGGRDIGL-IRTPSVGFTDLINKVALPSFSEESDRFVDTWCV 164

  Fly   177 IHGWGKVTMKEKSASLQQAPVPILNKELCQVIYKLPAS-QMCAGFLQGGIDACQGDSGGPLIC-- 238
            ..|||.:.....:..||...|.|::...|:..|...|| .||.....|. .:|.|||||||:.  
  Fly   165 ACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGK-SSCGGDSGGPLVTHD 228

  Fly   239 DGRLAGIISWG-VGCADPGYPGVYTNVSHFLKWIRRANASLDY 280
            :.||.|:|::| |.|...  |..||.|:.:|.|| |.|..:.|
  Fly   229 NARLVGVITFGSVDCHSG--PSGYTRVTDYLGWI-RDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 64/259 (25%)
Tryp_SPc 38..273 CDD:238113 66/260 (25%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 64/259 (25%)
Tryp_SPc 40..263 CDD:238113 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.