DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG16998

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:287 Identity:89/287 - (31%)
Similarity:131/287 - (45%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHY 65
            |:.|.:.||::..|.          |:..||   ..:||||..|.|...|:..|:   ::|.   
  Fly     1 MNILALILLLICGHK----------TSALSP---QERIVGGVEVPIHLTPWLASI---TVHG--- 46

  Fly    66 GLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVG 130
              .:.|..|:|:...:.:|.||          .:.|:.|.|.|||:.   ||...|...|..::.
  Fly    47 --NYSCSSALITSLWLVTAGHC----------VQYPDSYSVRAGSTF---TDGGGQRRNVVSVIL 96

  Fly   131 HKDYNGSTLENDIALLFLN---------GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGK--VT 184
            |.|:|..|||||||||.|:         ..:....|.:..:|         .|.|:.|||.  .|
  Fly    97 HPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILP---------RTLLVAGWGNPDAT 152

  Fly   185 MKEKSASLQQAPVPILNKELCQVIYK-----LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAG 244
            ..|....|:...|.::|:.|||.:|.     :....:||.  ..|.|.|.||||.||:..|...|
  Fly   153 DSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLVHRGSSYG 215

  Fly   245 IISWGVGCADPGYPGVYTNVSHFLKWI 271
            |:|:..|||||.:|||||.:::::.||
  Fly   216 IVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/249 (32%)
Tryp_SPc 38..273 CDD:238113 81/250 (32%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 79/249 (32%)
Tryp_SPc 25..242 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.