DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG6462

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:127/273 - (46%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQPTATASPFVILPKIVGGYTVTIDQVPFQVS-VRRRSIHERHYGLGHV-CGGAVISQRVVCSAA 85
            |..||     .:..:|.||...|....|:||. |.:.|      |...| |||::|:.:.|.:||
  Fly    67 GNQTA-----AVRTRIAGGELATRGMFPYQVGLVIQLS------GADLVKCGGSLITLQFVLTAA 120

  Fly    86 HCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG 150
            ||.. :.....:|....::..|..|  ::......:::::     :.||.|....:|:||:.|..
  Fly   121 HCLT-DAIAAKIYTGATVFADVEDS--VEELQVTHRDFII-----YPDYLGFGGYSDLALIRLPR 177

  Fly   151 FIPWESPGVRAIPLAIKAPEE----GTTCLIHGWGKV--TMKEKSASLQQAPVPILNKELCQVIY 209
            .:. .|..|:.|.||.:...:    |....:.|||.:  :..:::..||.....::::|.| :.|
  Fly   178 KVR-TSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERC-ICY 240

  Fly   210 KLP--ASQ---MCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWG--VGCADPGYPGVYTN 263
            .||  .||   :|... ..|..||.||||||::...|    |.|:.|:|  .|| :.|.|.|||.
  Fly   241 FLPGLVSQRRHLCTDG-SNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTR 303

  Fly   264 VSHFLKWIRRANA 276
            ::.:|.|||:..|
  Fly   304 ITAYLPWIRQQTA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/252 (28%)
Tryp_SPc 38..273 CDD:238113 73/253 (29%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 71/252 (28%)
Tryp_SPc 77..314 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.