DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG1299

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:326 Identity:89/326 - (27%)
Similarity:134/326 - (41%) Gaps:107/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 THSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQV--------------------SVRR 57
            |..|||.:       |.:|..|:||       ..|::|.::                    .|.|
  Fly   218 TGQGITNT-------TPAPSQIVPK-------NTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSR 268

  Fly    58 RSI--------HERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAID 114
            :..        ::...|....|||.:|:.|.|.:||||..           .:|..|..|...:.
  Fly   269 KGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHCIR-----------QDLQFVRLGEHDLS 322

  Fly   115 RTDRFT--QEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLI 177
             ||..|  .:..:.|.|.|.|||.....:|:|:|:|...:.:.|   :..|:          ||.
  Fly   323 -TDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTS---KIAPI----------CLP 373

  Fly   178 H-----------------GWGKVTMK--EKSASLQQAPVPILNKELCQVIY----------KLPA 213
            |                 |||| ||:  |.:..|.:..:||.:.::|...|          :...
  Fly   374 HTANLRQKSYVGYMPFVAGWGK-TMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDK 437

  Fly   214 SQMCAGFLQGGIDACQGDSGGPLIC----DGR----LAGIISWGVGCADPGYPGVYTNVSHFLKW 270
            :.:|||.|.||.|.|||||||||:.    .|:    |.|::|:|:|||.|..||||::..:|:.|
  Fly   438 AVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDW 502

  Fly   271 I 271
            |
  Fly   503 I 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/300 (26%)
Tryp_SPc 38..273 CDD:238113 80/301 (27%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 76/268 (28%)
Tryp_SPc 261..503 CDD:238113 76/267 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.