DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG14990

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:129/263 - (49%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            |:...|: |..|.|:.|::..:.   :::|     .|::|:..||.:||       |:.:...|.
  Fly    61 KVPKDYS-TPGQFPWVVALFSQG---KYFG-----AGSLIAPEVVLTAA-------SIVVGKTDA 109

  Fly   102 ELYVVVAGSSAIDRTDRF--TQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWE-SPGVRAIP 163
            |: ||.||.....:...|  :::..|.|:|.|::::.....|:||||||..  |:| ...:|.|.
  Fly   110 EI-VVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLAN--PFELKSHIRTIC 171

  Fly   164 LAIKAPEEGTT-----CLIHGWGKVTMKEKSASLQQAPV--PILNKELCQ---------VIYKLP 212
            |    |.:|.:     ||:.|||||...:::.|..|..:  |::|:..||         |.:.||
  Fly   172 L----PSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLP 232

  Fly   213 ASQMCAGFLQGGIDA--CQGDSGGPLICDGRL-------AGIISWGVGCADPGYPGVYTNVSHFL 268
            ||.:|||   |..||  |.||.|..|.|....       |||::||:||.:...|.|||||..|.
  Fly   233 ASLICAG---GEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFR 294

  Fly   269 KWI 271
            .||
  Fly   295 DWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/261 (32%)
Tryp_SPc 38..273 CDD:238113 84/262 (32%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 83/257 (32%)
Tryp_SPc 67..297 CDD:214473 81/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.