DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG32271

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:281 Identity:92/281 - (32%)
Similarity:136/281 - (48%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHY 65
            |..||:.|.::             |...|:......:||||..|.|..||:.|::|        .
  Fly     1 MATLWLVLHLI-------------PLCWAASNEANSRIVGGVPVDIASVPYLVNLR--------I 44

  Fly    66 GLGHVCGGAVISQRVVCSAAHCY-AINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
            |...:|||::::.:.|.:||||. .|..|         ..:||||.:.:..|...:.   |.::.
  Fly    45 GGNFMCGGSLVTPQHVVTAAHCVKGIGAS---------RILVVAGVTRLTETGVRSG---VDKVY 97

  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQ- 193
            ..|.||..||.:|:|:|.|..  |...|.|..|.|...:.:.|....:.|||::|.:.|:.|:| 
  Fly    98 TPKAYNTRTLTSDVAVLKLKA--PISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNKAVSMQV 160

  Fly   194 -QAPVPILNKELCQVIYKLPA----SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCA 253
             ...|.::.::.|...|||..    :..||. :.|..|||:||||||.:..|:|.||:|||||||
  Fly   161 RSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCA 224

  Fly   254 DPGYPGVYTNVSHFLKWIRRA 274
            ....|||||||.....:|.:|
  Fly   225 RKSSPGVYTNVKTVRSFIDKA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/240 (35%)
Tryp_SPc 38..273 CDD:238113 85/241 (35%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 84/240 (35%)
Tryp_SPc 25..244 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5520
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.