DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG3650

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:284 Identity:84/284 - (29%)
Similarity:132/284 - (46%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQV-PFQVSVRRRSIHERHYGL 67
            :|..|.::.    :||..:|..:..     |.|:||||.|.|:..| .|.|::|        |..
  Fly     1 MWRPLFLLQ----LTQLLLGLASGQ-----IQPRIVGGTTTTLSAVGGFVVNLR--------YDG 48

  Fly    68 GHVCGGAVISQRVVCSAAHC---YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
            ...|||::::...|.:||||   |..:.            :.|.|.     ..:.:|..:|:|:.
  Fly    49 TFYCGGSLVTSSHVVTAAHCLKGYQASR------------ITVQGG-----VSKLSQSGVVRRVA 96

  Fly   130 GH---KDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS 191
            .:   ..::.|:|..|:.::.|...:  ...|:..|||.......|....:.|||.......|.|
  Fly    97 RYFIPNGFSSSSLNWDVGVIRLQSAL--TGSGITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPS 159

  Fly   192 --LQQAPVPILNKELCQVIYK----LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGV 250
              |:...:.::.|::||..|:    |.||..||  ..||.|:|.|||||.:|...:|.||:|||:
  Fly   160 NQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCA--RTGGKDSCSGDSGGGVIFKNQLCGIVSWGL 222

  Fly   251 GCADPGYPGVYTNVSHFLKWIRRA 274
            |||:..||||||:|.....:|.|:
  Fly   223 GCANAQYPGVYTSVHRVRSFILRS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/246 (30%)
Tryp_SPc 38..273 CDD:238113 76/247 (31%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 75/246 (30%)
Tryp_SPc 26..243 CDD:238113 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.