DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG15873

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:244 Identity:71/244 - (29%)
Similarity:109/244 - (44%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPE 102
            |.|||....:::...|...|...:.||.|..|.|.|.::|.|.|.:||||........:   :|.
  Fly    36 ISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASM---NPR 97

  Fly   103 LYVVVAGS----SAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
            ...||.|.    :..|.:| |..   |.|:|.|.:|. ...:||:|:|.|:..:  :|.....:|
  Fly    98 GIRVVFGHITRLAVYDESD-FRS---VDRLVVHPEYE-RYKKNDLAILRLSERV--QSSNHDVLP 155

  Fly   164 LAIKAPEE---GTTCLIHGWGKVTMK-EKSASLQQAPVPILNKELCQVIYKLPAS--QMCAGFLQ 222
            |.::....   |.||:..|||::... ..|..|....|.:....|||..|....:  .:|...:.
  Fly   156 LLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVG 220

  Fly   223 GGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ..:: |.||.||||:|.|.|.|:|...:|||. |....:.:..::..||
  Fly   221 ESMN-CAGDMGGPLLCKGALFGLIGGHMGCAG-GKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/242 (29%)
Tryp_SPc 38..273 CDD:238113 71/244 (29%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 66/224 (29%)
Tryp_SPc 59..250 CDD:238113 60/201 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.