DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG32269

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:128/263 - (48%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVV 81
            ::..::.|....|:...|..:||||.:.||...|:.|.:||.|         ::|.|::|:::.|
  Fly    88 LSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGS---------NLCSGSLITEQWV 143

  Fly    82 CSAAHC---YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDI 143
            .:||||   |:.:.           :.|..|::.:|.:|..|:.  |..|.....:....:..|.
  Fly   144 LTAAHCVKGYSASD-----------FTVRGGTTTLDGSDGVTRS--VSSIHVAPKFTSKKMNMDA 195

  Fly   144 ALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWG--KVTMKEKSASLQQAPVPILNKELCQ 206
            |||.||..:...:.|  .|.:....|:.|:...|.|||  |......|.:||.|.:.::.::.|:
  Fly   196 ALLKLNQSLTGTNIG--TISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCR 258

  Fly   207 VIYKLPAS----QMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHF 267
            ..|:..|:    .:||  ...|.|:|.||||||:..:..|.||:|:|.|||..|||||||.|...
  Fly   259 KDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAI 321

  Fly   268 LKW 270
            .:|
  Fly   322 RQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/243 (32%)
Tryp_SPc 38..273 CDD:238113 77/242 (32%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 76/241 (32%)
Tryp_SPc 121..324 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.