DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG8299

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:267 Identity:103/267 - (38%)
Similarity:143/267 - (53%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC--- 87
            |.:||   |...||||....|...|:|||||..:     |.|.|:|||::.:.|||.:||||   
  Fly    19 TDSAS---ISTHIVGGDQADIADFPYQVSVRLET-----YMLLHICGGSIYAPRVVITAAHCIKG 75

  Fly    88 -YAINTSVPLVYRDPELYV-VVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNG 150
             ||             .|: :|||.::|  .|...|...|.:::.|..||..|..|||.|:....
  Fly    76 RYA-------------SYIRIVAGQNSI--ADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITRE 125

  Fly   151 FIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELC--QVI-- 208
              |.| |..|:.|.:|::||..|...::.||||....:::  |.|:...:.|:.|..|  |.:  
  Fly   126 --PLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTK 188

  Fly   209 -YKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI- 271
             |.:....:|||:|:||.|.|.|||||||..||.|.|::||||||...|:|||||:|:..:.|| 
  Fly   189 DYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIE 253

  Fly   272 RRANASL 278
            .:|.|.|
  Fly   254 EQAEAYL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 94/246 (38%)
Tryp_SPc 38..273 CDD:238113 96/248 (39%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 94/246 (38%)
Tryp_SPc 28..255 CDD:238113 96/248 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.