DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Ser8

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:278 Identity:90/278 - (32%)
Similarity:138/278 - (49%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGG 73
            |:..|:..:.  .||....|:|   :..:||||...:|:..|:|||::|..        .|.|||
  Fly    11 LLALTNGAVI--PIGLEPQTSS---LGGRIVGGTASSIEDRPWQVSLQRSG--------SHFCGG 62

  Fly    74 AVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ--RIVGHKDYNG 136
            ::||..::.:||||....|:|..:.       :.|||:     .|.....||:  .|..|:.||.
  Fly    63 SIISNNIIVTAAHCLDTPTTVSNLR-------IRAGSN-----KRTYGGVLVEVAAIKAHEAYNS 115

  Fly   137 STLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKV-TMKEKSASLQQAPVPIL 200
            ::..|||.::.|...:.:.|. ::||.:|...|..|:...|.||||. |....||:|......|:
  Fly   116 NSKINDIGVVRLKTKLTFGST-IKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIV 179

  Fly   201 NKELC-QVIYK----LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGV 260
            .:..| ...|.    :.|:.:||.....  |||||||||||:..|:|.|::|||..||...||||
  Fly   180 GRSQCGSSTYGYGSFIKATMICAAATNK--DACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGV 242

  Fly   261 YTNVSHFLKWIRRANASL 278
            |.|::....|:.:|..::
  Fly   243 YANIAELRDWVLQAQKTV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 82/241 (34%)
Tryp_SPc 38..273 CDD:238113 83/242 (34%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/241 (34%)
Tryp_SPc 35..253 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.