DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Prss56

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:291 Identity:96/291 - (32%)
Similarity:140/291 - (48%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQPTATASPFVILP---------------------KIVGGYTVTIDQVPFQVSVRRRSIHERHYG 66
            |:|...||.|...|                     :||||.|..:...|:.|.::          
  Rat    76 GRPRPQASVFQDPPPEPGPCGERRQSVANTTRAHGRIVGGSTAPLGAWPWLVRLQ---------- 130

  Fly    67 LG--HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVA----GSSAIDRTDRFTQEYLV 125
            ||  .:|||.:::...|.:||||:| ..|..|::.     |::|    |..|        :|..|
  Rat   131 LGGLPLCGGVLVAASWVLTAAHCFA-GASNELLWT-----VMLAEGPQGEQA--------EEVQV 181

  Fly   126 QRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVR---AIPLAIKAPEEGTTCLIHGWGKVTMK- 186
            .||:.|..::..|..||:||:.|  :.|..|.|..   .:|...:.|..||.|.|.|||.:... 
  Rat   182 NRILPHPKFDPQTFHNDLALVQL--WTPVNSEGPARPICLPEGSREPPAGTPCTIAGWGALFEDG 244

  Fly   187 EKSASLQQAPVPILNKELCQVIY---KLPASQMCAGFLQGGIDACQGDSGGPLICDGR------- 241
            .:|.::::|.||:|:.:.||...   ..|::.:|||:|.||||:|||||||||.|...       
  Rat   245 PESEAVREARVPLLSADTCQKALGPGLSPSTMLCAGYLAGGIDSCQGDSGGPLTCSEPGPRPREV 309

  Fly   242 LAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            |.|:.|||.||.:||.|||||.|:.|..|::
  Rat   310 LFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 89/253 (35%)
Tryp_SPc 38..273 CDD:238113 90/255 (35%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.