DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and iotaTry

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:264 Identity:86/264 - (32%)
Similarity:118/264 - (44%) Gaps:63/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :|:||....|...|:|||::..:.||        |||.:.|:.::.:|.||        |..|..
  Fly    27 RIIGGSDQLIRNAPWQVSIQISARHE--------CGGVIYSKEIIITAGHC--------LHERSV 75

  Fly   102 ELYVVVAGSSAIDRTDRFTQEY-----LVQRIVGHKDYNGSTLENDIALLFLNGFIPWESP---- 157
            .|..|..|:.        ...|     .|.....|:.::...|..|||:|.|:      :|    
  Fly    76 TLMKVRVGAQ--------NHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLS------TPLTFG 126

  Fly   158 -GVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYKLPASQ------ 215
             ..|||.||..:|..|||..:.|||.......|.|||:|.:.|:::..|       |||      
  Fly   127 LSTRAINLASTSPSGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGEC-------ASQKFGYGA 184

  Fly   216 -------MCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI-R 272
                   :||.....  |||.|||||||:...:|.||:|||..|||..|||||.:|:....|| :
  Fly   185 DFVGEETICAASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK 247

  Fly   273 RANA 276
            .|||
  Fly   248 AANA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/256 (32%)
Tryp_SPc 38..273 CDD:238113 83/258 (32%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 81/256 (32%)
Tryp_SPc 28..247 CDD:238113 83/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.