DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and etaTry

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:100/249 - (40%)
Similarity:138/249 - (55%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY-RD 100
            :||||...:.....:.|.:||||.....|  ...|||.::....:.:||||         || |:
  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSY--AQTCGGCILDAVTIATAAHC---------VYNRE 80

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES-PGVRAIPL 164
            .|.::||||..:  |.........|.:::.|:.||.||::|||||:.::..:|.:| ..:.||.:
  Fly    81 AENFLVVAGDDS--RGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEI 143

  Fly   165 AIKAPEEGTTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELCQ-VIYKLPASQ--MCAGFLQG 223
            |.:.|..|....|.|||..  ||...|   |||..|||::.|.|| ..|..|.|:  :|||..:|
  Fly   144 ASEQPAVGVQATISGWGYT--KENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAGLSEG 206

  Fly   224 GIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            |.|||||||||||:...:||||:|||.|||.|.|||||.||:::..||.:...|
  Fly   207 GKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAKQRTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 97/241 (40%)
Tryp_SPc 38..273 CDD:238113 99/242 (41%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 97/241 (40%)
Tryp_SPc 28..257 CDD:238113 99/243 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.