DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and zetaTry

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:253 Identity:97/253 - (38%)
Similarity:139/253 - (54%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :|||||...|.|||:|:|:|.:.|........|.|||::.::..:.:|||| .|.|..       
  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHC-VIGTVA------- 94

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD-YNGSTLENDIALLFLNGFIPWESPGVRAIPLA 165
            ..|.||||::....:|.....  |:.||.|:. |:|:...||||:||::..:|..:..::||.||
  Fly    95 SQYKVVAGTNFQTGSDGVITN--VKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLA 157

  Fly   166 IKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELC--------QVIYKLPASQMCAGFL 221
            ::.|.|||...:.|||..:....|:: |....|||::.|||        ...|::.::.:|||..
  Fly   158 LEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKR 222

  Fly   222 -QGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASL 278
             .||.|||||||||||.....|.|::|||..||.|.|||||.||::...||....|.|
  Fly   223 GVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLAGL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 93/244 (38%)
Tryp_SPc 38..273 CDD:238113 95/245 (39%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 93/244 (38%)
Tryp_SPc 39..276 CDD:238113 95/246 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.