DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG13744

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:274 Identity:82/274 - (29%)
Similarity:113/274 - (41%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :|:||......:.|:|..:|   |.|      :.|||.:||..:|.:||||          .:..
  Fly   141 RIIGGRPAQFAEYPWQAHIR---IAE------YQCGGVLISANMVATAAHC----------IQQA 186

  Fly   102 ELYVVVAGSSAIDRTD--------RFTQEYLVQRIVGHKDYNGSTLE---NDIALL-------FL 148
            .|..:......:|..|        ...:..::|:|: |..:|....:   .|||||       |.
  Fly   187 HLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKII-HPRFNFRMTQPDRYDIALLKLAQPTSFT 250

  Fly   149 NGFIPWESP--GVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS---LQQAPVPILNKELC--- 205
            ...:|...|  .:|.|         |...||.||||.......|.   ||.|.|||:....|   
  Fly   251 EHILPICLPQYPIRLI---------GRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRW 306

  Fly   206 ----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYT 262
                |:..::.|...|||...|.:|||.|||||||:...|    |.||.|.|.||.....||:|.
  Fly   307 HESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYH 371

  Fly   263 NVSHFLKWIRRANA 276
            ||...::||:...|
  Fly   372 NVQKTVRWIQEVVA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/267 (30%)
Tryp_SPc 38..273 CDD:238113 81/268 (30%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 79/267 (30%)
Tryp_SPc 142..383 CDD:238113 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.