DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Np

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:259 Identity:86/259 - (33%)
Similarity:135/259 - (52%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSVR--RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY 98
            |:||||......:.|:|:|:|  |.|.:.      |.||.|::::....:||||.   .:||   
  Fly   796 PRIVGGANAAFGRWPWQISLRQWRTSTYL------HKCGAALLNENWAITAAHCV---DNVP--- 848

  Fly    99 RDPELYVVVAGSSAIDRTDRF-TQEYLVQRIVGHKDYNGSTLENDIALL-FLNGFIPWESPGVRA 161
             ..:|.:.:......:..:.: .||..||.:..|..::..|.|.|:||| |....|  ..|.:  
  Fly   849 -PSDLLLRLGEYDLAEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVI--FQPNI-- 908

  Fly   162 IPLAIKAPEE---GTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYK-------LPASQ 215
            ||:.:...:|   |.|..:.|||::.......| ||:..||::|..:|:.:|:       :|...
  Fly   909 IPVCVPDNDENFIGQTAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIF 973

  Fly   216 MCAGFLQGGIDACQGDSGGPLI----CDGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|||:.:||.|:|:||||||::    .|.|  |.|:||||:|||:...|||||.:|.|..||.:
  Fly   974 ICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQ 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/254 (33%)
Tryp_SPc 38..273 CDD:238113 85/255 (33%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 83/254 (33%)
Tryp_SPc 798..1038 CDD:238113 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.