DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and flz

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:287 Identity:92/287 - (32%)
Similarity:138/287 - (48%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG----HVC 71
            :|.||..|:..:       .|.|...:||||...|....|:||.||..:      .||    :.|
  Fly  1429 LAFHSPSTECGV-------RPHVKSGRIVGGKGSTFGAYPWQVLVREST------WLGLFTKNKC 1480

  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPEL---YVVVAGSSAI--DRTDRFTQEYLVQRIVGH 131
            ||.:|:.|.|.:||||            .|..   .|.|.|...|  |...:.:....|:|::.|
  Fly  1481 GGVLITSRYVITAAHC------------QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVH 1533

  Fly   132 KDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIK---APEEGTTCLIHGWGKVTMKEKSAS-L 192
            :.|:.:|.|||:|||.|:..:.:::   ..:|:.:.   |...|....:.|||::.......| |
  Fly  1534 RQYDPATFENDLALLELDSPVQFDT---HIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPSVL 1595

  Fly   193 QQAPVPILNKELCQVIY-------KLPASQMCAGFLQGGIDACQGDSGGPLIC---DGR--LAGI 245
            |:..|||:...:||.::       |:..|.:|||:..|..|:|:|||||||:.   |||  |||.
  Fly  1596 QEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGT 1660

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWIR 272
            :|.|:.||.|..||||...:.:..|:|
  Fly  1661 VSHGIKCAAPYLPGVYMRTTFYKPWLR 1687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/258 (33%)
Tryp_SPc 38..273 CDD:238113 86/260 (33%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 86/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.