DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Jon44E

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:290 Identity:77/290 - (26%)
Similarity:125/290 - (43%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLIVATHSGITQSQIGQPTATASPFVILP-------KIVGGYTVTIDQVPFQVSVRRRSIHERH 64
            ||.:.:  :|:..|:    :|.|.|...:|       :|..||.....::|:.|.:   |.::. 
  Fly     9 CLAVAS--AGVVPSE----SARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGL---SFNDG- 63

  Fly    65 YGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIV 129
               |:.|||::|....|.:||||......| |:|...........:..:.|:|          ::
  Fly    64 ---GYWCGGSIIDHTWVLTAAHCTNSANHV-LIYFGASFRHEAQYTHWVSRSD----------MI 114

  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPE--------EGTTCLIHGWGKVTMK 186
            .|.|:| ..|.|||||:.:.....|      ::...::.|.        .|...:..||| :|..
  Fly   115 QHPDWN-DFLNNDIALIRIPHVDFW------SLVNKVELPSYNDRYNSYSGWWAVASGWG-LTDN 171

  Fly   187 EKSAS--LQQAPVPILNKELCQVIY---KLPASQMCAGFLQGGIDACQGDSGGPLIC--DGRLAG 244
            ....|  |....|.|::...|:..|   .:..:.:|.. ..||..:|.|||||||:.  :.|:.|
  Fly   172 NSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNNRIVG 235

  Fly   245 IISW--GVGCADPGYPGVYTNVSHFLKWIR 272
            |:|:  |.||. .|.|..:|.|:.:|.|||
  Fly   236 IVSFGSGEGCT-AGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 66/250 (26%)
Tryp_SPc 38..273 CDD:238113 69/252 (27%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 66/250 (26%)
Tryp_SPc 41..266 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.