DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG4793

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:340 Identity:90/340 - (26%)
Similarity:139/340 - (40%) Gaps:98/340 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPTATASPFVILPKIVGGYTVT-------IDQVPFQVSV---RRRSIHERHYGLGHVCGGAVISQ 78
            ||..|....|  .:|..|:|:|       ..::|:.|::   |.|      ..||   ||::|::
  Fly    80 QPLPTECGHV--NRIGVGFTITNARDIAQKGELPWMVALLDSRSR------LPLG---GGSLITR 133

  Fly    79 RVVCSAAHCYAINTSVPLVYRDPELYVVV-AGSSAID--RTDRFTQEYLVQRIVGHKDYNGSTLE 140
            .||.         ||.......||.|::| ||....:  ..:|..::..:::||.|.:.:.....
  Fly   134 DVVL---------TSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGA 189

  Fly   141 NDIALLFLNGFIPWESPGVRAIPL---------AIKAPEEG---TTCLIHGWGKVTMKEKSAS-- 191
            |:.|||||            |.||         .:..|...   ..|::.||||.|..:.|..  
  Fly   190 NNAALLFL------------ARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNI 242

  Fly   192 LQQAPVPILNKELCQV--------IYKLPASQMCAGFLQGGIDACQGDSGGPLICD-------GR 241
            |::..:|::::.:||.        .:.|..|.:|||. :.|.|.|:||.|.||.|.       ..
  Fly   243 LKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRYE 306

  Fly   242 LAGIISWGVGCADPGYPGVYTNVSHFLKWI------------------RRANASLDYSEYRQIPP 288
            |.||:::|.||..| .|..||:||....||                  .::.|.||    |.||.
  Fly   307 LLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVHYSPQLGNVGQSPAPLD----RYIPN 366

  Fly   289 LNLASRRSVSSSCLG 303
            :.|.::..|.|...|
  Fly   367 IGLETQNEVHSPVQG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/275 (27%)
Tryp_SPc 38..273 CDD:238113 76/294 (26%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/263 (27%)
Tryp_SPc 105..335 CDD:214473 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.