DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS48

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:336 Identity:110/336 - (32%)
Similarity:161/336 - (47%) Gaps:90/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC 87
            |||       |...::|||......:.|:|||:        |:....:|||:::|:|::.:||||
Human    43 GQP-------VYSSRVVGGQDAAAGRWPWQVSL--------HFDHNFICGGSLVSERLILTAAHC 92

  Fly    88 YAINTSVPLVYRDPE----LYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALL-- 146
            .           .|.    .|.|..||..:. ..|...:|.|.:||.|..|..:|.  |:|||  
Human    93 I-----------QPTWTTFSYTVWLGSITVG-DSRKRVKYYVSKIVIHPKYQDTTA--DVALLKL 143

  Fly   147 -----FLNGFIPWESPGVR---AIPLAIKAPEEGTTCLIHGWGKVTMKEKS-----ASLQQAPVP 198
                 |.:..:|...|.|.   |||         ..|.:.|||||  ||.|     ::||:|.||
Human   144 SSQVTFTSAILPICLPSVTKQLAIP---------PFCWVTGWGKV--KESSDRDYHSALQEAEVP 197

  Fly   199 ILNKELCQVIYK-----LPA-------SQMCAGFLQGGIDACQGDSGGPLIC--DG--RLAGIIS 247
            |::::.|:.:|.     |||       .::|||..|...|:|:|||||||.|  ||  ...|::|
Human   198 IIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVS 262

  Fly   248 WGVGCADPGYPGVYTNVSHFLKWIR----RANASLDYSEYRQIPPLNLASRRSVSSSCL------ 302
            ||:.|. ...|||||||.::.|||.    ||| :||:|::  :.|:.|.|...:..||.      
Human   263 WGLECG-KSLPGVYTNVIYYQKWINATISRAN-NLDFSDF--LFPIVLLSLALLRPSCAFGPNTI 323

  Fly   303 -GIGVLALAMS 312
             .:|.:|.|::
Human   324 HRVGTVAEAVA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 90/268 (34%)
Tryp_SPc 38..273 CDD:238113 92/273 (34%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 90/268 (34%)
Tryp_SPc 51..288 CDD:238113 92/270 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.