DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:263 Identity:98/263 - (37%)
Similarity:135/263 - (51%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            |.:|:||........|:|||:        |:.....||.:|||:..:.|||||:..|.     ..
Human   603 LHRIIGGTDTLEGGWPWQVSL--------HFVGSAYCGASVISREWLLSAAHCFHGNR-----LS 654

  Fly   100 DP-----ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGV 159
            ||     .|.:.|.|::      :|...  |:|||.|:.||..|.:.|||||.|:  |.|.....
Human   655 DPTPWTAHLGMYVQGNA------KFVSP--VRRIVVHEYYNSQTFDYDIALLQLS--IAWPETLK 709

  Fly   160 RAI-PLAI----KAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIYKLPASQM- 216
            :.| |:.|    :....|..|.:.|||:....:...|  ||||.|.::::.||...|.:..|:| 
Human   710 QLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRML 774

  Fly   217 CAGFLQGGIDACQGDSGGPLIC----DGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRRAN 275
            |||.:.|..|||:|||||||.|    ||:  |.||:|||.|...|.:|||||.||:|:.||.:..
Human   775 CAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWIHKYV 839

  Fly   276 ASL 278
            .||
Human   840 PSL 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 93/252 (37%)
Tryp_SPc 38..273 CDD:238113 95/253 (38%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.