DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG5390

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:338 Identity:88/338 - (26%)
Similarity:137/338 - (40%) Gaps:99/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCL--LIVATHSGITQSQIGQ--------------PTATASP-FVILP---------------- 36
            |:|.  .|..:..||...::|.              |.....| |...|                
  Fly    81 WLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGVGF 145

  Fly    37 KIVGGYT--VTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            ||.|...  ....:.|:.:::.|   .|.:..| :.||||:|:..||.:||||        :..:
  Fly   146 KITGAVNQEAEFGEFPWMLAILR---EEGNLNL-YECGGALIAPNVVLTAAHC--------VHNK 198

  Fly   100 DPELYVVVAG------SSAIDR-TDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESP 157
            .|...||.||      .:.|.| .||:.:|     |:.|:.:|..:|.||:|::.|      |||
  Fly   199 QPSSIVVRAGEWDTQTQTEIRRHEDRYVKE-----IIYHEQFNKGSLYNDVAVMLL------ESP 252

  Fly   158 -----GVRAIPLAIKAPEEG-----TTCLIHGWGKVTM---KEKSASLQQAPVPILNKELCQVIY 209
                 .::.:.|    |..|     ..|...||||...   .|....|::..:|::.::.|:...
  Fly   253 FTLQENIQTVCL----PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNL 313

  Fly   210 K---------LPASQMCAGFLQGGIDACQGDSGGPLICD-------GRLAGIISWGVGCADPGYP 258
            :         |..|.:|||. :...|.|:||.|.||:|.       .:.|||::||:||.:...|
  Fly   314 RETRLGRHFILHDSFICAGG-EKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIP 377

  Fly   259 GVYTNVSHFLKWI 271
            |||.:|:....||
  Fly   378 GVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/271 (28%)
Tryp_SPc 38..273 CDD:238113 77/272 (28%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 75/266 (28%)
Tryp_SPc 153..390 CDD:214473 73/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.