DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CFI

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001362207.1 Gene:CFI / 3426 HGNCID:5394 Length:601 Species:Homo sapiens


Alignment Length:310 Identity:77/310 - (24%)
Similarity:121/310 - (39%) Gaps:99/310 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC--------YAINTS 93
            :||||....:..:|:||:::..|        |..|||..|....:.:||||        |.|.|:
Human   347 RIVGGKRAQLGDLPWQVAIKDAS--------GITCGGIYIGGCWILTAAHCLRASKTHRYQIWTT 403

  Fly    94 VPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG 158
            | :.:..|:|             .|...|| |.||:.|::||..|.:|||||      |..:..|
Human   404 V-VDWIHPDL-------------KRIVIEY-VDRIIFHENYNAGTYQNDIAL------IEMKKDG 447

  Fly   159 -------VRAIPLAIK-AP---EEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIY--K 210
                   .|:||..:. :|   :...||::.|||:....|:..|||...|.:::.  |...|  :
Human   448 NKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISN--CSKFYGNR 510

  Fly   211 LPASQM-CAGFLQGGIDACQGDSGGPLICDGRLAGIISW-GVGCADPGYPGV--YTNVSHFLKWI 271
            ....:| ||       |.|.....|           :.| .:....|..|..  ::.:|....| 
Human   511 FYEKEMECA-------DCCSVAQAG-----------VQWHDLSSLQPPPPRFKQFSCLSLPSSW- 556

  Fly   272 RRANASLDYSEYRQIPP--------------LNLASRRSVSSSCLGIGVL 307
                      :||.:||              .||:|.:..|:|.:.:.:|
Human   557 ----------DYRHLPPRPESRSVPQAGVQWCNLSSLQHPSTSWVQVILL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 66/258 (26%)
Tryp_SPc 38..273 CDD:238113 67/259 (26%)
CFINP_001362207.1 FIMAC 43..108 CDD:214493
SR 114..215 CDD:214555
LDLa 224..256 CDD:238060
Ldl_recept_a 257..293 CDD:365841
Tryp_SPc 348..>519 CDD:238113 57/201 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.