DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and OVCH1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_024304736.1 Gene:OVCH1 / 341350 HGNCID:23080 Length:1120 Species:Homo sapiens


Alignment Length:302 Identity:96/302 - (31%)
Similarity:141/302 - (46%) Gaps:43/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG-HVCGGA 74
            |:|...|.....|.|  ..||..:..:|.||........|:||.:|         .|| :.||||
Human   585 VSTVKAILHDVCGIP--PFSPQWLSRRIAGGEEACPHCWPWQVGLR---------FLGDYQCGGA 638

  Fly    75 VISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTL 139
            :|:...:.:||||..:.       .:|..:.::||....:..:...|....:.|:.|:|:|..:.
Human   639 IINPVWILTAAHCVQLK-------NNPLSWTIIAGDHDRNLKESTEQVRRAKHIIVHEDFNTLSY 696

  Fly   140 ENDIALLFLNGFIPWESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTMKEKSAS-LQQAPVPILN 201
            ::||||:.|:..:.:.|. ||.:.|...|..  ....|.:.|||.::.....|| |||..|.:|.
Human   697 DSDIALIQLSSPLEYNSV-VRPVCLPHSAEPLFSSEICAVTGWGSISADGGLASRLQQIQVHVLE 760

  Fly   202 KELCQVIY------KLPASQMCAGFLQGG-IDACQGDSGGPLICDGR-----LAGIISWGVGCAD 254
            :|:|:..|      .:....:||||...| .|.|||||||||:|...     |.||:|||.||..
Human   761 REVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCRHENGPFVLYGIVSWGAGCVQ 825

  Fly   255 PGYPGVYTNVSHFLKWIR---RANASLDYSE-----YRQIPP 288
            |..|||:..|..||.||:   ...|||..:.     .:|:||
Human   826 PWKPGVFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPP 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/249 (33%)
Tryp_SPc 38..273 CDD:238113 83/253 (33%)
OVCH1XP_024304736.1 Tryp_SPc 58..294 CDD:238113
CUB 336..444 CDD:238001
CUB 454..565 CDD:238001
Tryp_SPc 610..845 CDD:238113 83/251 (33%)
CUB 881..978 CDD:238001
CUB 1017..1119 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.