DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS38

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:298 Identity:94/298 - (31%)
Similarity:145/298 - (48%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVA------------THSGITQS---QIGQPTATASPFVILPKIVGGYTVTIDQVPFQV 53
            |.:.||:||            .:.||:.:   ..|:|:...       ||:||......:.|:||
Human    18 LLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEG-------KILGGVPAPERKWPWQV 75

  Fly    54 SVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP--ELYVVVAGSSAIDRT 116
            ||        ||...|||||:::::..|.|||||:         :||.  ::|.:..|...:...
Human    76 SV--------HYAGLHVCGGSILNEYWVLSAAHCF---------HRDKNIKIYDMYVGLVNLRVA 123

  Fly   117 DRFTQEYLVQRIVGHKDYN-GSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT---CLI 177
            ...||.|.|.|::.|..|. ...:..|:||:.|...|.:..   ..:|:.:..||...|   |..
Human   124 GNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSE---SVLPVCLATPEVNLTSANCWA 185

  Fly   178 HGWGKVTMK-EKSASLQQAPVPILNKELCQVIY----KLPASQMCAGFLQGGIDACQGDSGGPLI 237
            .|||.|:.: |.|..||:..:|::.:..|.::|    .:....:|||.:......|:|||||||:
Human   186 TGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLV 250

  Fly   238 CDGRLA----GIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |:...:    ||:|||.||::|.|||||.:||:|.|||
Human   251 CEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 83/248 (33%)
Tryp_SPc 38..273 CDD:238113 84/249 (34%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.