DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG4271

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:284 Identity:81/284 - (28%)
Similarity:111/284 - (39%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            |:.:|...:.:|                     |..|.....|...|..||.....||       
  Fly     7 WVLILFARSSNG---------------------IYNGVEAKFDFWTFLASVWVSGYHE------- 43

  Fly    70 VCGGAVISQRVVCSAAHC--------YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ 126
             ||||||..|:|.:||.|        ..:....|.:||...:..|.|                  
  Fly    44 -CGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIRVTA------------------ 89

  Fly   127 RIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGK-------VT 184
             :|.|::|  ...:||||||:|..  |..|..|..||||.|.|.|.......|||:       ||
  Fly    90 -LVVHENY--KNWDNDIALLWLEK--PVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVT 149

  Fly   185 MKEKSASLQQAPVPILNKELC--QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
            .|     ||.....|..:.:|  :::..:....:||.:.:.  |.|.||.||||:...::.||..
  Fly   150 RK-----LQNGVTKIRPRSMCAEELVEPVGEELLCAFYTEN--DICPGDYGGPLVLANKVVGIAV 207

  Fly   248 WGVGCADPGYPGVYTNVSHFLKWI 271
            .|.||.....|.:||||.|:|:||
  Fly   208 QGHGCGFAVLPSLYTNVFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/250 (30%)
Tryp_SPc 38..273 CDD:238113 78/251 (31%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 78/251 (31%)
Tryp_SPc 19..231 CDD:214473 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.