DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Send1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:292 Identity:84/292 - (28%)
Similarity:141/292 - (48%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVATHSGITQSQIGQPTATASPFVILP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVC 71
            |::|.|..|:      |..   |.::.|  :|:||.::.|..||:|||:       ::|| .|.|
  Fly     8 LLLAVHLLIS------PVV---PVLLEPSERIIGGSSMDITDVPWQVSL-------QYYG-EHFC 55

  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRF--TQEYLVQRIVGHKDY 134
            ||::.|:.::.:||||          .::.| ..:.||||..|.....  .:.|::     |..:
  Fly    56 GGSIYSKTIIITAAHC----------IKEGE-RSIRAGSSLHDSGGVVVGVEAYII-----HPQF 104

  Fly   135 NGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPI 199
            :...:|||:|:|.|:..:.: |..::.||||...|...::.|..|||:.....:...||...:.|
  Fly   105 DKHNMENDVAVLKLSSPLSF-SDSIQTIPLAETDPPTSSSALATGWGRGNFLIRPRQLQGVEILI 168

  Fly   200 LNKELCQVIY--KLPASQMCAGFL-QGGIDACQGDSGGPLICDGRLAGIIS--WGVGCADPGYPG 259
            ....:|::.|  .:....:|||.: :||   |.|||||||:.:|:|.||.|  ..:.|..   ..
  Fly   169 RPLIVCKLKYGNGVFNEDICAGRMGKGG---CYGDSGGPLVFNGQLVGITSRTGNIVCLG---SS 227

  Fly   260 VYTNVSHFLKWIRRANASLDYSEYRQIPPLNL 291
            :|.:|:.:..||..|...|.:    |.|..|:
  Fly   228 LYASVARYRNWILSAIDVLHF----QAPATNV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/240 (29%)
Tryp_SPc 38..273 CDD:238113 72/241 (30%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 70/240 (29%)
Tryp_SPc 30..239 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.