DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Ser12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:274 Identity:93/274 - (33%)
Similarity:147/274 - (53%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH 69
            |  |::||:.:.|        :|.:||    .:||||:.|.|.:||:|.::.        |...:
  Fly     5 W--LVLVASVTLI--------SAGSSP----ERIVGGHPVLISEVPWQAALM--------YSEKY 47

  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRD-PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            :||..:.|.:::.:||||         |.|. ..||.|..||...:...:..:..::::   |:|
  Fly    48 ICGAVIYSDKIIITAAHC---------VERPFDTLYSVRVGSVWKNLGGQHARVAVIRK---HED 100

  Fly   134 YNGST-LENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKV-TMKEKSASLQQAP 196
            |..|| |.||||::.|...:.:.:. ||.|.||..||..||...:.|||:: .:..:..||.:..
  Fly   101 YVSSTILFNDIAVIRLVDTLIFNAE-VRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTS 164

  Fly   197 VPILNKELCQVIYK-LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGV 260
            |.||:..:|:..|: :..:.:||..|..  |:|.|||||||:..|:|.||:|:|:|||:|.:|||
  Fly   165 VKILDPNVCKRSYQYITKTMICAAALLK--DSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGV 227

  Fly   261 YTNVSHFLKWIRRA 274
            |.||:....||..|
  Fly   228 YANVAELKPWILNA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 82/237 (35%)
Tryp_SPc 38..273 CDD:238113 84/238 (35%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 82/237 (35%)
Tryp_SPc 24..238 CDD:238113 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.