DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG4259

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:269 Identity:78/269 - (28%)
Similarity:118/269 - (43%) Gaps:53/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSA 84
            :||.:.|..::|....|.:|.    .:||         |....|:.|:     |::|:..||.:|
  Fly    24 NQIRRETYGSNPRATFPWVVS----VLDQ---------RDWLFRYIGV-----GSLINPNVVLTA 70

  Fly    85 AHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYL---VQRIVGHKDYNGSTLENDIALL 146
            ||.....|...||.|..|.          |.:....|:::   |..||.|:.:|....||::|||
  Fly    71 AHILNGTTKYDLVVRAGEW----------DTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALL 125

  Fly   147 FLNGFIPWESPGVRAIPLAIKAPEEGT---TCLIHGWGKVTMK--EKSASLQQAPVPILNKELCQ 206
            .|...... :..:..|||.::  |.|.   :|..:|||||.:.  :....|:...|.:|:..:|.
  Fly   126 ILVSAFEM-TANINLIPLYLQ--EAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCS 187

  Fly   207 VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRL---------AGIISWGVGCADPGYPGVYT 262
             ..|||..|:|...|: ||| |.||.|.||:|  |:         .||::|...........|:|
  Fly   188 -SRKLPIQQICGKGLE-GID-CSGDGGAPLVC--RILTYPYKYAQVGIVNWLSQKPVENTFIVFT 247

  Fly   263 NVSHFLKWI 271
            ||:..|.||
  Fly   248 NVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/250 (28%)
Tryp_SPc 38..273 CDD:238113 73/251 (29%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 74/254 (29%)
Tryp_SPc 39..256 CDD:214473 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.