DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP009006

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_552907.3 Gene:AgaP_AGAP009006 / 3291875 VectorBaseID:AGAP009006 Length:401 Species:Anopheles gambiae


Alignment Length:227 Identity:57/227 - (25%)
Similarity:89/227 - (39%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGAVISQRVVCSAAHCYAI----NTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGH 131
            |.|.:|:...|.:.|.|..:    .|:|..:|         .|::.|.|         |:..:.:
Mosquito   205 CTGTLINLNTVLTTAGCANMVSVGETNVARIY---------DGAAQIIR---------VKETIRY 251

  Fly   132 KDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI-----KAPEEGTTCLIHGWGK-VTMKEKS- 189
            ..||..|.:||||:|.|...:   .....|||..:     :.|..|..  :|..|: :|.::|: 
Mosquito   252 PSYNAKTHDNDIAVLKLESDV---LVNENAIPACLWRDLNRTPYYGQE--VHFDGQSLTARDKNV 311

  Fly   190 -----ASLQQAPVPILNKELCQVIYKLPASQMCAGFLQGGIDA--CQGDSGGPLICDGR------ 241
                 ..|..:...:.|.:||...::|...         |.||  | |..|.|.|...|      
Mosquito   312 VHNRDCQLFTSHTELTNDQLCWQEFRLRPD---------GADAPNC-GRKGNPFITLQRTNNIYL 366

  Fly   242 --LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
              |.|:.|:...||. |.|.|.|.:|.::.||
Mosquito   367 PYLVGLYSYDRQCAG-GEPIVATRISSYINWI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 55/225 (24%)
Tryp_SPc 38..273 CDD:238113 57/227 (25%)
AgaP_AGAP009006XP_552907.3 Tryp_SPc <1..64 CDD:304450
Tryp_SPc 184..398 CDD:304450 57/227 (25%)
Tryp_SPc 184..397 CDD:214473 55/225 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.