DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:258 Identity:87/258 - (33%)
Similarity:137/258 - (53%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSVR--RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY 98
            |:||||......:.|:|:|:|  |.|.:.      |.||.|::::....:||||.   .:||   
Mosquito     5 PRIVGGTKAAFGRWPWQISLRQWRTSTYL------HKCGAALLNENWAITAAHCV---DNVP--- 57

  Fly    99 RDPELYVVVAG--SSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRA 161
              |...::..|  ..|::......||..||.:..|..::..|.|.|:|||.....:.:: |.:  
Mosquito    58 --PSDLLLRLGEYDLALEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVVFQ-PNI-- 117

  Fly   162 IPLAIKAPEE---GTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQVIYK-------LPASQ 215
            ||:.:...:|   |.|..:.|||::.......| ||:..||::...:|:.:|:       :|...
Mosquito   118 IPVCVPENDENFIGRTAFVTGWGRLYEDGPLPSVLQEVTVPVIENNICETMYRSAGYIEHIPHIF 182

  Fly   216 MCAGFLQGGIDACQGDSGGPLI---CDGR--LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|||:.:||.|:|:||||||::   .|.|  |||:||||:|||:|..|||||.:|.|..||.:
Mosquito   183 ICAGWKKGGYDSCEGDSGGPMVIQRTDKRFLLAGVISWGIGCAEPNQPGVYTRISEFRDWINQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/253 (33%)
Tryp_SPc 38..273 CDD:238113 86/254 (34%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 84/253 (33%)
Tryp_SPc 7..246 CDD:238113 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.