DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPC1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:256 Identity:76/256 - (29%)
Similarity:118/256 - (46%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GYTVTIDQVPFQVSVRRRSIHERHYGLG------HVCGGAVISQRVVCSAAHCY-AINTSVPLVY 98
            |:|.....|..:::..|...|....|.|      ::|||:::|.|.:.:|.||. :.|.....:.
Mosquito   136 GHTAVELIVDGELAKAREFPHMALIGFGEAPEIRYLCGGSLVSDRFILTAGHCLTSTNFGPATIV 200

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
            |..||      |.|....:.|.::|.:...:.|.:|..::..|||||:.||..:.: ||..|.|.
Mosquito   201 RLGEL------SLASSTDEAFPEDYDIAERIPHPEYKQTSHYNDIALIKLNRKVIF-SPYARPIC 258

  Fly   164 LAIKAPEEGTTCLIHGWGKVTM-KEKSASLQQAPVPILNKELCQVIY----KL-----PASQMCA 218
            |.::|.......:..|||.:.. .|:|::|.:..:.:...|.|:..:    ||     ..:|:||
Mosquito   259 LPLQAAIPQKRAIATGWGAIGFGLEQSSALLKVTLDMFRFEECKDQFEPTRKLRTGLNATTQLCA 323

  Fly   219 GFLQGGIDACQGDSGGPL--------ICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            |......|.|||||||||        .|...:.|:.|:|..|...|.|.|||.|..:|.||
Mosquito   324 GSRNSTKDTCQGDSGGPLQVYNDANVYCTYTIIGVTSFGQNCGLAGVPAVYTTVYSYLSWI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/254 (29%)
Tryp_SPc 38..273 CDD:238113 76/256 (30%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 74/249 (30%)
Tryp_SPc 143..384 CDD:214473 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.