DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:245 Identity:87/245 - (35%)
Similarity:122/245 - (49%) Gaps:40/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV-CGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ||||..|.|:|||:|.::         ..||.| |||::|..|.|.:|.||        :.:..|
Mosquito    39 IVGGMKVDIEQVPYQAAI---------LTLGQVHCGGSIIGPRWVLTAYHC--------VDWLLP 86

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNG-STLEN---DIALLFLNGFIPWESPGVRAI 162
            ..|.|..||         |..|..|||:..:.:.. .||.:   ||||..|...:.:.|. |:.|
Mosquito    87 NFYEVAVGS---------TNPYEGQRILVQELFVPLETLSDPNFDIALAKLAHTLQYSST-VQCI 141

  Fly   163 PLAIK----APEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK--LPASQMCAGFL 221
            ||...    .|:  |...|.|:|....:.....|:.|.:.:|..:.||..|.  :....:||||.
Mosquito   142 PLLTSDSSLIPD--TPAYISGFGYTKERASDNILKAAQIKVLPWDYCQQAYPYLMREFMLCAGFK 204

  Fly   222 QGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :|.:|:||||||||||.:.:|||::.:|.|||.|.:||||.:|..|..||
Mosquito   205 EGKVDSCQGDSGGPLIVNAKLAGVVFYGEGCARPHFPGVYISVPWFSDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/243 (35%)
Tryp_SPc 38..273 CDD:238113 87/245 (36%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 87/245 (36%)
Tryp_SPc 39..254 CDD:214473 85/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.