DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011920

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_552320.3 Gene:AgaP_AGAP011920 / 3291457 VectorBaseID:AGAP011920 Length:169 Species:Anopheles gambiae


Alignment Length:167 Identity:52/167 - (31%)
Similarity:77/167 - (46%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ATASPFVILP-------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSA 84
            |||...|:.|       :||||.....:|.|:|||:|..       |..|.|||::|:.|.|.||
Mosquito    14 ATALGNVLSPEYYEWAGRIVGGQNAGTNQFPYQVSLRSS-------GNSHFCGGSIINNRYVLSA 71

  Fly    85 AHCYAINTSVPLVYRDPELYV---VVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALL 146
            |||....|:...:.....:::   .:|.|:|              |||.|..||.:||.||::|:
Mosquito    72 AHCTIGRTTANTISVVGAIFLNGGGIAHSTA--------------RIVNHPSYNANTLANDVSLV 122

  Fly   147 FLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKV 183
            ....||.: :..|:.|.|.... ..|...:..|||::
Mosquito   123 QTATFITY-TAAVQPIALGTNF-VTGGGAVASGWGQL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 47/150 (31%)
Tryp_SPc 38..273 CDD:238113 47/149 (32%)
AgaP_AGAP011920XP_552320.3 Tryp_SPc 31..>168 CDD:214473 47/150 (31%)
Tryp_SPc 32..>168 CDD:238113 47/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.