DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:248 Identity:78/248 - (31%)
Similarity:115/248 - (46%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||||........|:.||: |.||::      |:|||.::|.|.|.|:|:|        |..|..
Mosquito    23 RIVGGIDAVAGDAPWMVSL-RNSINQ------HLCGGTLLSNRFVLSSANC--------LSGRLA 72

  Fly   102 ELYVVVAGSSAIDRTDRFTQ----EYLVQRIVGHKDYNGSTLENDIALLFLNG--FIPWESPGVR 160
            ...:.||||       ||..    .|...:|:.|.::|.:|||:|:| ||...  ||..:|  |:
Mosquito    73 TATMAVAGS-------RFLNTAAIPYYGIQIITHPNFNVNTLEHDVA-LFQTALQFILTQS--VQ 127

  Fly   161 AIPLAIKAPEEGTTCLIHGWGKVTMK-EKSASLQQAPVPILNKELCQVI-----YKLPASQMCAG 219
            .:||:......|....:.|||..... ..:.:||...|..|:.:.|...     :::..|.:|..
Mosquito   128 PLPLSADVIGVGVRARVFGWGASQANGGNTNALQFLNVNTLSNDDCANFLGAEGWRIGPSSLCTL 192

  Fly   220 FLQG-GIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ..:| ||  |.||.||.|:.|....|:.|||:.|| .|.|.|:..:|....||
Mosquito   193 TREGQGI--CGGDEGGALVLDNYAIGVASWGIPCA-TGRPDVFVRISAVRSWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/246 (31%)
Tryp_SPc 38..273 CDD:238113 78/247 (32%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 76/246 (31%)
Tryp_SPc 24..242 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.