DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPA12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_320731.3 Gene:CLIPA12 / 3291430 VectorBaseID:AGAP011781 Length:379 Species:Anopheles gambiae


Alignment Length:231 Identity:73/231 - (31%)
Similarity:102/231 - (44%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            :.|.|::::..|..:.|||....||..|:.|..| :.....|..:...|...:|.|:     |..
Mosquito   148 YACVGSLVAPNVALTVAHCVINKTSTRLLVRAGE-WDTRTESEVLPYQDARVKEVLI-----HDR 206

  Fly   134 YNGSTLENDIALLFL-NGFIPWES--------PGVRAIPLAIKAPEEGTTCLIHGWGK---VTMK 186
            || .....|:|||.| ..|.|.|:        ||||        |..|:.||..||||   ..|.
Mosquito   207 YN-KHHHFDVALLVLVQPFQPAENVQTICLPPPGVR--------PPVGSECLTGGWGKDRFGVMG 262

  Fly   187 EKSASLQQAPVPILNKELCQVI---------YKLPASQMCAGFLQGGIDACQGDSGGPLIC---- 238
            .....|::..:||::...||..         |||.:|.:|||..:.. |.|.||.||.|:|    
Mosquito   263 VYQHILKRVELPIVDSAQCQQALRKTRLGAGYKLHSSFLCAGGKKDA-DVCSGDGGGALVCLMPG 326

  Fly   239 ---DGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
               :...||:::||:||.|...||||.:|.....||
Mosquito   327 SQTNYYQAGVVAWGIGCGDENIPGVYADVESSRGWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/229 (31%)
Tryp_SPc 38..273 CDD:238113 73/231 (32%)
CLIPA12XP_320731.3 Tryp_SPc 120..362 CDD:214473 71/229 (31%)
Tryp_SPc 120..362 CDD:238113 71/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.