DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001252

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_321900.3 Gene:AgaP_AGAP001252 / 3290448 VectorBaseID:AGAP001252 Length:271 Species:Anopheles gambiae


Alignment Length:273 Identity:80/273 - (29%)
Similarity:123/273 - (45%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            |::||..:|  :..:|:..|.| |.....:||||:.|.|.|.|:|:|:        .|...|:||
Mosquito     8 LIVVAAIAG--EGVLGREAAPA-PARATGRIVGGWEVYIGQFPYQLSL--------EYDGYHICG 61

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS 137
            .:.::.|:..:|.||........|..|        .|||.::.....   :.|:::|.|.||:.|
Mosquito    62 ASAVAPRLALTAGHCCIGTNETDLTVR--------GGSSTLEEGGIV---FPVKKLVIHPDYDDS 115

  Fly   138 TLENDIALL-----FLN----GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA-SL 192
            .|:.|:.:|     |.|    |.|...|.|  .||       .|...::.|||......... :|
Mosquito   116 NLDFDVCVLRIGGTFQNKSNIGIIQPTSSG--TIP-------SGELAIVTGWGATESNGNFVPNL 171

  Fly   193 QQAPVPILNKELC--QVIYKLPA--SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCA 253
            :...|.:.:.:.|  |....:.:  |.||||.:  |...|.|||||||:.|.|..||:|:.:...
Mosquito   172 RSLAVKVWSTKNCTDQAANYMTSSGSMMCAGSV--GRSFCVGDSGGPLVYDQRQIGIVSFLINEC 234

  Fly   254 DPGYPGVYTNVSH 266
            ....|.:||.:||
Mosquito   235 GGTAPAIYTRLSH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 72/244 (30%)
Tryp_SPc 38..273 CDD:238113 72/243 (30%)
AgaP_AGAP001252XP_321900.3 Tryp_SPc 34..254 CDD:214473 72/244 (30%)
Tryp_SPc 35..257 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.