DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP006489

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_557171.2 Gene:AgaP_AGAP006489 / 3290176 VectorBaseID:AGAP006489 Length:278 Species:Anopheles gambiae


Alignment Length:291 Identity:72/291 - (24%)
Similarity:110/291 - (37%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV 70
            :|||:     |:..||...||       :|...:.|        .|...||.::..|..:     
Mosquito     7 LCLLV-----GLIGSQAQTPT-------LLRDTIWG--------EFPSVVRVKTPRENQF----- 46

  Fly    71 CGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGS------SAIDRTDRFTQEYLVQRIV 129
            |.|.||:...|.::|.|......:.:.   |...|.|.|.      :||.|..|..|...|    
Mosquito    47 CLGTVINSNHVLTSAFCVLSYDRMRIF---PARLVRVIGGDISVTPAAITRQTRTGQHIFV---- 104

  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQ 194
             |:||...|.||::|::.|.......|..:....:.::...|...|.:..|.:....|.:.| |:
Mosquito   105 -HEDYRPHTYENNLAIIRLAEPFHLPSNAIEEAVIRMRIVPEQHPCDVVTWYRAPGTEGNPS-QE 167

  Fly   195 AP------VPILNKELC----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG 249
            .|      |.|.|:::|    :..:.|..:.:|. :....|...|||   |:.|||.|..|.|:.
Mosquito   168 IPRQQAFNVNIRNRDVCAAERRTEFTLEENSLCT-YTTTTIGVVQGD---PMFCDGELTSIQSYV 228

  Fly   250 VGCADPGYPG---------VYTNVSHFLKWI 271
            ......|.|.         |.|.|..:|.||
Mosquito   229 FLPPVTGQPQPQPQNQPNLVSTQVRFYLHWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 61/258 (24%)
Tryp_SPc 38..273 CDD:238113 63/259 (24%)
AgaP_AGAP006489XP_557171.2 Tryp_SPc 30..225 CDD:304450 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.