DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:257 Identity:79/257 - (30%)
Similarity:126/257 - (49%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG-HVCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            ::|.|......|.|:||::.      .::..| .:|||:|:::..:.:||||.:..::.      
Mosquito    56 RVVNGQEALPGQFPYQVALL------LNFPDGTALCGGSVLTRNFILTAAHCVSATSTT------ 108

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRI----VG---HKDYNGSTLENDIALLFLNGFIPWESPG 158
                :|..|.:.:...:|...|...|||    .|   |.:|:.::|.||:||:.||..:.:.|  
Mosquito   109 ----LVSGGIAIMGAHNRTAMELSQQRIRFTSTGIRRHPEYDDTSLRNDVALILLNSPMTFTS-- 167

  Fly   159 VRAIPLAIKAPE-----EGTTCLIHGWGKVT--MKEKSASLQQAPVPILNKELCQVI--YKLPAS 214
             |..|:::.|..     ||.|..:.|:|:.:  ....|:.|:....||::|..|.|.  :.|..|
Mosquito   168 -RVKPISLPARTDTRQFEGFTGTVSGFGRSSDASPYPSSILRFTSNPIMSKAECIVSWGFALAQS 231

  Fly   215 QMCAGFLQGGIDACQGDSGGPLICD--GRL-AGIISWG--VGCADPGYPGVYTNVSHFLKWI 271
            |.......||..:|.|||||||..:  |.| .|.:|:|  .|||. |:|.||..||:||.||
Mosquito   232 QNVCLKPTGGRSSCNGDSGGPLTVNSGGVLQIGTVSFGSSYGCAS-GWPSVYARVSYFLSWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/255 (30%)
Tryp_SPc 38..273 CDD:238113 79/256 (31%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 77/255 (30%)
Tryp_SPc 57..295 CDD:238113 79/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.