DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:276 Identity:76/276 - (27%)
Similarity:124/276 - (44%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLV 97
            ||  :|..|...|..|.|:|:::    :.....|.| :|||:|::...:.:||||.....:.   
Mosquito    68 LPSHRITNGQEATPGQFPYQIAL----LSNFATGTG-LCGGSVLTNNYILTAAHCVISGATT--- 124

  Fly    98 YRDPELYVVVAGSSAIDRTDRFTQEYLVQR-------IVGHKDYNGSTLENDIALLFLNGFIPWE 155
                   :..:|::.:...:|...|...||       |..|..||.:.:.||||::.||..|.:.
Mosquito   125 -------LATSGTAIMGAHNRNVNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFT 182

  Fly   156 SPGVRAIPLAIKAPEE-----GTTCLIHGWGKVTMKEKSASLQQAPV------PILNKELCQVIY 209
            :   |..|:.:....:     |.|..:.|:|:.|....:     :||      |::....|...:
Mosquito   183 A---RIQPIRLPGRSDSRQFGGFTGTVSGFGRTTNTGAT-----SPVVMFTSNPVMTNADCIARW 239

  Fly   210 KL----PASQMCAGFLQGGIDACQGDSGGPL-ICDG--RLAGIISWG--VGCADPGYPGVYTNVS 265
            ..    |.:...:|  .||..:|.||||||| :.||  ...||:|:|  .||: .|.|.||..||
Mosquito   240 NTALIQPQNVCLSG--DGGRSSCNGDSGGPLTVQDGGSLQIGIVSFGSAAGCS-IGMPSVYARVS 301

  Fly   266 HFLKWIRRANASLDYS 281
            .:|.||   :|:.|::
Mosquito   302 FYLDWI---DANSDFN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/260 (27%)
Tryp_SPc 38..273 CDD:238113 72/261 (28%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 70/260 (27%)
Tryp_SPc 73..310 CDD:238113 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.